Influenza Virus NS1A Binding Protein (IVNS1ABP) Rabbit Polyclonal Antibody TA332035 from OriGene Technologies | Biocompare.com

Supplier Images

Influenza Virus NS1A Binding Protein (IVNS1ABP) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Influenza Virus NS1A Binding Protein (IVNS1ABP) Rabbit Polyclonal Antibody

OriGene Technologies' Influenza Virus NS1A Binding Protein (IVNS1ABP) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunohistochemistry, and Western Blot. The Influenza Virus NS1A Binding Protein (IVNS1ABP) Rabbit Polyclonal Antibody was generated using IVNS1ABP as the antigen and it reacts with Human.

Description

Rabbit Polyclonal Anti-IVNS1ABP Antibody

Product Specs
ItemInfluenza Virus NS1A Binding Protein (IVNS1ABP) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA332035
Quantity100 µl
ApplicationsIHC, WB
Conjugate/TagUnconjugated
ReactivityHuman
TargetIVNS1ABP
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-IVNS1ABP Antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP. Synthetic peptide located within the following region: RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK
NCBI Full Gene Nameinfluenza virus NS1A binding protein
NCBI Gene AliasesARA3, NS-1, FLARA3, KLHL39, NS1BP, NS1-BP, ND1, IMD70, HSPC068
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!